What's new

Protein giả làm DNA để kháng fluoroquinolone ở M. tuberculosis

Nguyễn Xuân Hưng

Administrator
Protein giả làm DNA để kháng fluoroquinolone ở M. t

A fluoroquinolone resistance protein from Mycobacterium tuberculosis that mimics DNA.
Hegde SS, Vetting MW, Roderick SL, Mitchenall LA, Maxwell A, Takiff HE, Blanchard JS
Science 2005 Jun 3 308(5727):1480-3

F1000 Factor 3.0

Laurence Pearl
Institute of Cancer Research, United Kingdom
STRUCTURAL BIOLOGY

This paper describes the structure of a protein from Mycobacterium tuberculosis that confers resistance to fluoroquinolone antibiotics (e.g. ciprofloxacin), which bind to DNA Gyrase - DNA complexes and promote bacteriocidal DNA double strand breaks. Remarkably, the MfpA protein mimics the structure and charge distribution of B-form DNA, and binds to DNA gyrase A subunit competitively with DNA, thereby preventing formation of lethal GyrA-DNA-fluoroquinolone complexes. Reversible inhibition of GyrA by MfpA must cause some problems, but at least rescues it from the lethal effects of fluoroquinolones.

Evaluated 6 Jun 2005


Bài báo này mô tả cấu trúc của một protein ở Mycobacterium tuberculosis có tác dụng kháng các kháng sinh họ fluoroquinolone (như ciprofloxacin). Kháng sinh họ fluoroquinolone gắn với phức hệ DNA Gyrase - DNA và đẩy mạnh việc phá vỡ DNA mạch kép của vi khuẩn xâm hại. Kỳ lạ là protein MfpA bắt chước cấu trúc cũng như phân bố điện tích của DNA dạng B và cạnh tranh với DNA để gắn với dưới đơn vị A của DNA gyrase, do đó ngăn cản sự tạo thành của phức hệ gây chết GyrA-DNA-fluoroquinolone. Sự kìm hãm thuận nghịch GyrA bởi MfpA có thể gây ra một số vấn đề nhưng ít nhất giúp nó thoát khỏi hiệu ứng độc của các fluoroquinolone.
 

Cao Xuân Hiếu

Administrator
Bài này cực hay, tôi viết lại cho dễ hiểu

Bài báo này mô tả cấu trúc của một protein ở Mycobacterium tuberculosis có tác dụng kháng lại các kháng sinh họ fluoroquinolone (như ciprofloxacin). Kháng sinh họ fluoroquinolone liên kết với phức hệ DNA Gyrase - DNA làm phá vỡ DNA mạch kép của vi khuẩn xâm hại (do kìm chế hoạt tính hàn gắn sau khi cắt tháo xoắn của Gyrase) . Điểm mấu chốt của phát hiện này là protein MfpA có cấu trúc cũng như phân bố điện tích tương tự như DNA dạng B. Do đó, protein MfpA cạnh tranh với DNA tại vị trí liên kết thuộc tiểu đơn vị A của DNA gyrase, làm ngăn cản sự tạo thành của phức hệ gây chết GyrA-DNA-fluoroquinolone. Việc MfpM kìm hãm thuận nghịch GyrA có thể làm giảm tốc độ sinh trưởng của vi khuẩn trong các điều kiện môi trường thông thường nhưng lại giúp vi khuẩn sống sót dưới độc tố của fluoroquinolone. Về mặt lý thuyết, nghiên cứu này không chỉ làm sáng tỏ cơ chế hoạt động của DNA Gyrase, mà còn đề xuất chức năng của một nhóm protein điều hòa phổ biến (vì MfpA có thể tìm thấy ở cả sinh vật bậc cao). Về mặt thực tiễn, nghiên cứu có thể mở đường cho một kiểu thuốc kháng sinh mới bằng việc sử dụng các họ protein MfpA

1393a-1-thumb.gif


Hình: Cấu trúc không gian của MfpA (phải) và DNA (trái)
 

Nguyễn Xuân Hưng

Administrator
Tôi cũng thâý bài này hay nhưng F1000 Factor chỉ được có 3.0, chả hiểu sao nữa. Không biết họ đánh giá theo tiêu chí nào nhỉ.

Nếu Vietbio sửa lại (thêm một đoạn khá dài) thì khi đăng lên sẽ không được để tên người bình luân là Laurence Pearl nữa. Theo tôi, chỉ nên sửa lại đoạn tôi dịch cho xuôi và chính xác hơn. Còn nếu bổ sung thêm cho dễ hiểu hay cung câp thêm thông tin thì nên làm thành một bài riêng để tôn trọng bản quyền tác giả.
 

Ngô Vũ

Member
Bài bổ sung của vietbio đã làm cho tui có nhiều thắc mắc hơn:

Thắc mắc 1:
Việc MfpM kìm hãm thuận nghịch GyrA có thể làm giảm tốc độ sinh trưởng của vi khuẩn trong các điều kiện môi trường thông thường nhưng lại giúp vi khuẩn sống sót dưới độc tố của fluoroquinolone. Về mặt lý thuyết, nghiên cứu này không chỉ làm sáng tỏ cơ chế hoạt động của DNA Gyrase, mà còn đề xuất chức năng của một nhóm protein điều hòa phổ biến (vì MfpA có thể tìm thấy ở cả sinh vật bậc cao)

MfpM có thể là một protein cần thiết cho vi khuẩn họ M. tuberculosis, nhưng sự biểu hiện của nó có lẽ chỉ xuất hiện dưới sức ép chọn lọc (selective pressure) của thuốc kháng sinh họ fluoroquinolone. Do đó sự có mặt của MfpM trong điều kiện thông thường sẽ làm giảm tốc độ sinh trưởng của vi khuẩn là một điều nghịch lý, trừ khi ta biết tường tự hơn vai trò của protein này. Thế Vietbio có biết dẩn chứng ở đâu về vấn đề này, nhất là khả năng điều hòa và có mặt của chúng ở sinh vật bậc cao? Tui chưa có thời giờ đọc qua ref của bài gốc nhưng trong phần giới thiệu từ bài này tác giả nói là nhóm protein này chỉ có mặt ở vi khuẩn.

Thắc mắc 2:
Về mặt thực tiễn, nghiên cứu có thể mở đường cho một kiểu thuốc kháng sinh mới bằng việc sử dụng các họ protein MfpA

Chắc bạn có ý nói là thiết kế một chất ức chế mới để kìm hảm hoạt động của MfpA và dùng nó KẾT HỢP với fluoroquinolone để ngặn chận sự phát sinh của các dòng đề kháng thuốc fluoroquinolone? Nên nhớ là cơ chế hoạt động của MfpM được giả thuyết ở sự can thiệp vào phức hệ trung gian, bền vững DNA-gyrase-topoisomerase IV-fluoroquinolone, qua sự tranh giành và thay thế DNA trong phức hệ này và làm giảm số lượng DNA bị cắt đứt trong quá trình phản ứng này.

Còn nếu ý bạn là có thể dùng MfpA trực tiếp làm thuốc kháng sinh thì tui chưa được rỏ lắm vì không biết vì khả năng kết hợp của MfpA với tiểu đơn vị A của gyrase là không được chặt chẻ lắm.

Bài này rất hay, hoan hô Casper. Vì đây là một bài nặng về giải cấu trúc của MfpA nên rất tiếc là tác giả không có dịp để kiểm chứng giả thuyết của mình qua việc tạo một dòng vi khuẩn bị đột biến ở protein MfpA và chứng tỏ rằng khả năng đề kháng fluoroquinolone của vi khuẩn sẽ bị mất đi.

Chú thích nhỏ:
Reversible inhibition = kìm hảm thuận nghịch? Đọc tiếng Anh thỉ hiểu ngay nhưng đến tiếng Việt thì .... phải dò từ điển. Có từ nào hay hơn "thuận nghịch" không?
 

ruanhocon

Member
vietbio said:
Bài này cực hay, tôi viết lại cho dễ hiểu

Bài báo này mô tả cấu trúc của một protein ở Mycobacterium tuberculosis có tác dụng kháng lại các kháng sinh họ fluoroquinolone (như ciprofloxacin). Kháng sinh họ fluoroquinolone liên kết với phức hệ DNA Gyrase - DNA làm phá vỡ DNA mạch kép của vi khuẩn xâm hại (do kìm chế hoạt tính hàn gắn sau khi cắt tháo xoắn của Gyrase) . Điểm mấu chốt của phát hiện này là protein MfpA có cấu trúc cũng như phân bố điện tích tương tự như DNA dạng B. Do đó, protein MfpA cạnh tranh với DNA tại vị trí liên kết thuộc tiểu đơn vị A của DNA gyrase, làm ngăn cản sự tạo thành của phức hệ gây chết GyrA-DNA-fluoroquinolone. Việc MfpM kìm hãm thuận nghịch GyrA có thể làm giảm tốc độ sinh trưởng của vi khuẩn trong các điều kiện môi trường thông thường nhưng lại giúp vi khuẩn sống sót dưới độc tố của fluoroquinolone. Về mặt lý thuyết, nghiên cứu này không chỉ làm sáng tỏ cơ chế hoạt động của DNA Gyrase, mà còn đề xuất chức năng của một nhóm protein điều hòa phổ biến (vì MfpA có thể tìm thấy ở cả sinh vật bậc cao). Về mặt thực tiễn, nghiên cứu có thể mở đường cho một kiểu thuốc kháng sinh mới bằng việc sử dụng các họ protein MfpA

1393a-1-thumb.gif


Hình: Cấu trúc không gian của MfpA (phải) và DNA (trái)

Doc bai cua anh vietbio, em se duoc hieu la.. vi khuan M. tuberculosis sinh truong duoc trong dieu kien co mat k/sinh dong fluoroquinolone( dung la nhu selection) cho nen em cung ko hieu viec no sinh truong trong moi truong thong thuong la the nao? hay la cac vi khuan khac' voi M.tuberculosis??? hay co phai chi khi co chat khang sinh torg moi truong thi moi xuat hien MfpA...

Tuy nhien, viec mo ta duoc cau truc cua protein MfpA... cung la mot dieu rat y nghia... nhugn em cung hoi them la protein nay co duoc biet den nhu mot protein dong vai tro quyet dinh trong viec vi khuan nay khang lai chat khang sinh hay ko? Hay la no se con tuong tac voi cac loai protein khac ma ta chua biet'...

Nhung co le tai bai bao moi chi dung lai o de xuat, ma chua co su confirm nao day... nen moi chi dung lai o 3.0, tuc la nen doc no'.. chac vay casper nhi..:)
Chac phai doc ca bai thoi...:)

ruanhocon
 

Cao Xuân Hiếu

Administrator
tuchau said:
Bài bổ sung của vietbio đã làm cho tui có nhiều thắc mắc hơn:

Thắc mắc 1:
Việc MfpM kìm hãm thuận nghịch GyrA có thể làm giảm tốc độ sinh trưởng của vi khuẩn trong các điều kiện môi trường thông thường nhưng lại giúp vi khuẩn sống sót dưới độc tố của fluoroquinolone. Về mặt lý thuyết, nghiên cứu này không chỉ làm sáng tỏ cơ chế hoạt động của DNA Gyrase, mà còn đề xuất chức năng của một nhóm protein điều hòa phổ biến (vì MfpA có thể tìm thấy ở cả sinh vật bậc cao)

MfpM có thể là một protein cần thiết cho vi khuẩn họ M. tuberculosis, nhưng sự biểu hiện của nó có lẽ chỉ xuất hiện dưới sức ép chọn lọc (selective pressure) của thuốc kháng sinh họ fluoroquinolone. Do đó sự có mặt của MfpM trong điều kiện thông thường sẽ làm giảm tốc độ sinh trưởng của vi khuẩn là một điều nghịch lý, trừ khi ta biết tường tự hơn vai trò của protein này. Thế Vietbio có biết dẩn chứng ở đâu về vấn đề này, nhất là khả năng điều hòa và có mặt của chúng ở sinh vật bậc cao? Tui chưa có thời giờ đọc qua ref của bài gốc nhưng trong phần giới thiệu từ bài này tác giả nói là nhóm protein này chỉ có mặt ở vi khuẩn.

1. Đơn giản thôi, vai trò của MfpA cụ thể thế nào thì chưa kiểm chứng được, nhưng với cấu trúc giống DNA và khả năng bám vào Gyrase, ng ta có thể suy luận logic là thể này. Bình thường (ko kháng sinh), MfpA được tổng hợp dưới một cơ chế điều hòa nào đó nên nồng độ là vi lượng. MfpA cạnh tranh vị trí liên kết với DNA nên làm giảm tốc độ nhân đôi DNA. Cơ chế điều hòa này là kiểu chất cạnh tranh thuận nghịch (thuật ngữ chính xác thì quên mất rồi).

2. Trong môi trường có kháng sinh, chủng vi khuẩn đột biến hỏng cơ chế kiểm soát tổng hợp MfpA có lợi thế so sánh. -> trở thành chủng nhờn thuốc KS.

3. Nhóm tác giả này đã blast trình tự của MfpA lên genome của ruồi giấm, giun tròn, người, chuột và nấm men đều tìm được homologous sequence -> giả thuyết đây là cơ chế mang tính phổ biến.

Thắc mắc 2:
Về mặt thực tiễn, nghiên cứu có thể mở đường cho một kiểu thuốc kháng sinh mới bằng việc sử dụng các họ protein MfpA

Chắc bạn có ý nói là thiết kế một chất ức chế mới để kìm hảm hoạt động của MfpA và dùng nó KẾT HỢP với fluoroquinolone để ngặn chận sự phát sinh của các dòng đề kháng thuốc fluoroquinolone? Nên nhớ là cơ chế hoạt động của MfpM được giả thuyết ở sự can thiệp vào phức hệ trung gian, bền vững DNA-gyrase-topoisomerase IV-fluoroquinolone, qua sự tranh giành và thay thế DNA trong phức hệ này và làm giảm số lượng DNA bị cắt đứt trong quá trình phản ứng này.

Còn nếu ý bạn là có thể dùng MfpA trực tiếp làm thuốc kháng sinh thì tui chưa được rỏ lắm vì không biết vì khả năng kết hợp của MfpA với tiểu đơn vị A của gyrase là không được chặt chẻ lắm.

Dùng thẳng MfpA làm thuốc kháng sinh. Chắc là nhóm tác giả này đã đăng ký patent rồi chứ nếu ko các nhóm khác nhảy vô thì cũng dễ thôi. Phải tay tôi thì tôi sẽ modelling cái protein ấy nằm trong subunit A. Thay một vài aa ở vị trí quan trọng sẽ có thể làm tăng cường tính bám. Sau đấy chỉ phải vào phòng thí nghiệm để làm đột biến thực nghiệm nó và biểu hiện nó trong Baccilus chẳng hạn.

Một vấn đề quan trọng khác là tính đặc hiệu của MfpA giữa Gyrase vi khuẩn và eukaryote. Cái này phải kiểm tra cẩn thận ko thì thành cõng rắn cắn gà nhà.

Câu hỏi của em ruahocon hình như cũng đã được giải thích ở trên rồi đúng ko?

Bài này điểm thấp theo tôi vì nó chỉ là New finding và dựa vào kỹ thuật chủ yếu là "tạo tinh thể protein" chứ ko dùng nhiều kỹ thuật. Trong thời gian tới có thể điểm bài này sẽ tăng chút xíu nếu có thêm nhiều phản biện ủng hộ.

to hoangphuong: bạn tìm đọc về prion chắc sẽ thấy thích thú.
 

Nguyễn Xuân Hưng

Administrator
Reversible inhibition = kìm hảm thuận nghịch?

Chắc chắn đúng.

1. Đơn giản thôi, vai trò của MfpA cụ thể thế nào thì chưa kiểm chứng được, nhưng với cấu trúc giống DNA và khả năng bám vào Gyrase, ng ta có thể suy luận logic là thể này. Bình thường (ko kháng sinh), MfpA được tổng hợp dưới một cơ chế điều hòa nào đó nên nồng độ là vi lượng. MfpA cạnh tranh vị trí liên kết với DNA nên làm giảm tốc độ nhân đôi DNA. Cơ chế điều hòa này là kiểu chất cạnh tranh thuận nghịch (thuật ngữ chính xác thì quên mất rồi).

Tôi cũng chưa đọc fulltext nhưng anh có thể cho biết suy luận trên là của anh hay của tác giả đã công bố không? Vì đúng như anh tuchau đã nói, khi không có lợi ích gì thì bình thường M. tuberculosis chả có lý do gì để tổng hợp MfpA trong khi nó còn không có lợi cho chính M. tuberculosis nữa. Theo tôi, có thể coi MfpA là sản phẩm trao đổi chất bậc hai (secondary metabbolite) chỉ được tổng hợp khi M. tuberculosis gặp điều kiện bất lợi (có kháng sinh).
 

Cao Xuân Hiếu

Administrator
casper said:
1. Đơn giản thôi, vai trò của MfpA cụ thể thế nào thì chưa kiểm chứng được, nhưng với cấu trúc giống DNA và khả năng bám vào Gyrase, ng ta có thể suy luận logic là thể này. Bình thường (ko kháng sinh), MfpA được tổng hợp dưới một cơ chế điều hòa nào đó nên nồng độ là vi lượng. MfpA cạnh tranh vị trí liên kết với DNA nên làm giảm tốc độ nhân đôi DNA. Cơ chế điều hòa này là kiểu chất cạnh tranh thuận nghịch (thuật ngữ chính xác thì quên mất rồi).

Tôi cũng chưa đọc fulltext nhưng anh có thể cho biết suy luận trên là của anh hay của tác giả đã công bố không? Vì đúng như anh tuchau đã nói, khi không có lợi ích gì thì bình thường M. tuberculosis chả có lý do gì để tổng hợp MfpA trong khi nó còn không có lợi cho chính M. tuberculosis nữa. Theo tôi, có thể coi MfpA là sản phẩm trao đổi chất bậc hai (secondary metabbolite) chỉ được tổng hợp khi M. tuberculosis gặp điều kiện bất lợi (có kháng sinh).

Tôi cũng ko đọc hết :D. Protein điều hòa hay protein nói chung thì ít khả năng là sản phẩm TĐC bậc 2 vì đn~. Như tôi đã viết, MfpA được điều khiển bởi 1 operon riêng. Mọi chủng vk hoang dại ko có hoặc có rất ít MfpA (cái này chỉ cần RT-PCR là biết). Chủng đột biến nhờn KS thì là hỏng mất cơ chế điều khiển này -> MfpA tổng hợp nhiều hơn. Nếu chủng đột biến này sống trong môi trường ko có KS thì kém lợi thế so với chủng hoang dại, nhưng nếu có KS thì chủng hoang dại chết sạch.
 

Ngô Vũ

Member
Bác vietbio tìm những thứ này ở đâu vậy? Nếu là suy luận của mình thì nên nói vậy.

Bình thường (ko kháng sinh), MfpA được tổng hợp dưới một cơ chế điều hòa nào đó nên nồng độ là vi lượng. MfpA cạnh tranh vị trí liên kết với DNA nên làm giảm tốc độ nhân đôi DNA.

2. Trong môi trường có kháng sinh, chủng vi khuẩn đột biến hỏng cơ chế kiểm soát tổng hợp MfpA có lợi thế so sánh. -> trở thành chủng nhờn thuốc KS.

3. Nhóm tác giả này đã blast trình tự của MfpA lên genome của ruồi giấm, giun tròn, người, chuột và nấm men đều tìm được homologous sequence -> giả thuyết đây là cơ chế mang tính phổ biến.

Nếu không tìm được ref từ blast thì khỏi phải lo cái này:
Một vấn đề quan trọng khác là tính đặc hiệu của MfpA giữa Gyrase vi khuẩn và eukaryote. Cái này phải kiểm tra cẩn thận ko thì thành cõng rắn cắn gà nhà.

Như tôi đã viết, MfpA được điều khiển bởi 1 operon riêng.

Chủng đột biến nhờn KS thì là hỏng mất cơ chế điều khiển này -> MfpA tổng hợp nhiều hơn. Nếu chủng đột biến này sống trong môi trường ko có KS thì kém lợi thế so với chủng hoang dại,

Tui thì tìm được cái này từ bác:
Tôi cũng ko đọc hết :D.
 

Cao Xuân Hiếu

Administrator
Tôi cũng ko đọc hết :D.

Vì tôi đọc comment, nó được attached kèm đây.

Đây là suy luận của tôi với những phát hiện của bài báo. Tôi chưa đọc kỹ phần Discussion của họ, nhưng chắc cũng có những idea như vậy.

Như tôi đã viết, MfpA được điều khiển bởi 1 operon riêng.

Bình thường (ko kháng sinh), MfpA được tổng hợp dưới một cơ chế điều hòa nào đó nên nồng độ là vi lượng. MfpA cạnh tranh vị trí liên kết với DNA nên làm giảm tốc độ nhân đôi DNA.

Chủng đột biến nhờn KS thì là hỏng mất cơ chế điều khiển này -> MfpA tổng hợp nhiều hơn. Nếu chủng đột biến này sống trong môi trường ko có KS thì kém lợi thế so với chủng hoang dại,

Trong môi trường có kháng sinh, chủng vi khuẩn đột biến hỏng cơ chế kiểm soát tổng hợp MfpA có lợi thế so sánh. -> trở thành chủng nhờn thuốc KS.

Còn đây là một phần kết quả của nhóm tác giả và đề xuất:

Nhóm tác giả này đã blast trình tự của MfpA lên genome của ruồi giấm, giun tròn, người, chuột và nấm men đều tìm được homologous sequence -> giả thuyết đây là cơ chế mang tính phổ biến.

Fluoroquinolones are a relatively recent invention, so what is mfpA doing in bacteria in the first place? Related genes have been found in numerous bacteria, fruit flies, mice, and humans. Blanchard speculates that DNA-mimicking proteins could provide a general mechanism to regulate proteins that bind DNA. "The biology is extraordinarily rich and completely unknown," he says. "Who knows where it's going."

Việc đề xuất thuốc kháng sinh từ protein MfpA là từ bài comment với nguyên văn dưới đây.

It may be possible to turn the tables on bacteria by engineering MfpA to kill germs rather than protect them, researchers note. MfpA inhibits gyrase, which a bacterium needs in the long run to replicate its DNA and proliferate. "If I'm a clever chemist and I could build a small molecule that looks like that, then I have a new class of antibiotics," Wright says.
 

Ngô Vũ

Member
Cảm ơn vietbio. Tôi hỏi là tại vì không thấy nơi nào trong bài báo gốc đề cập đến việc blast hay đề xuất cơ chế của MfpA là phổ biến. Tôi thậm chí blast cDNA của MfpA thì cũng chỉ đụng mấy thằng vi khuẩn. Tìm kiếm trong pubmed với từ khóa MfpA cũng chẳng thấy đề cập đến vấn đề này. Chỉ có trong một review có nói đến MfpA có thể có gene tương tự trong thực vật. Thế thôi.

Hơn nữa, cái ông Dan Ferber, tác giả bài comment trên science chỉ là một anh viết dạo, không có credential trong khoa học. Do đó, tui rất ít đọc những loại tóm tắt kiểu này.

Thân.
 

Cao Xuân Hiếu

Administrator
Anh làm tôi phải tò mò thử blast cái. Chỉ chọn cái quan tâm. Một số k được mỹ mãn nhưng cũng đủ chứng minh lời cái ông gì gì nói. Để lúc nào tiện tôi thử email cho ổng xem ổng hâm cơ nào mà bọn chúng nó thuê viết bình luận trên Science.

Lineage Report

root
. cellular organisms
. . Bacteria [eubacteria]
. . . Actinomycetales [high GC Gram+]
. . . . Corynebacterineae [high GC Gram+]
. . . . . Mycobacterium [high GC Gram+]

. . . Wolbachia endosymbiont of Drosophila melanogaster ...................... 38 1 hit [a-proteobacteria] pentapeptide repeat domain protein [Wolbachia endosymbiont
. . Oryza sativa (japonica cultivar-group) (Japanese rice) ------------------- 66 9 hits [monocots] putative FH protein interacting protein FIP2 [Oryza sativa
. . Gallus gallus (chickens) ................................................. 50 3 hits [birds] hypothetical protein [Gallus gallus] >gi|61098191|ref|NP_00
. . Danio rerio (zebra fish) ................................................. 49 4 hits [bony fishes] potassium channel tetramerisation domain containing 9 [Dani
. . Canis familiaris (dogs) .................................................. 49 2 hits [mammals] PREDICTED: similar to potassium channel tetramerisation dom
. . Mus musculus (mouse) ..................................................... 42 6 hits [mammals] potassium channel tetramerisation domain containing 9 [Mus
. . Bos taurus (bovine) ...................................................... 36 1 hit [mammals] PREDICTED: similar to synaptic vesicle glycoprotein 2c [Bos
. . Caenorhabditis briggsae .................................................. 33 1 hit [nematodes] Hypothetical protein CBG00897 [Caenorhabditis briggsae]
. . Homo sapiens (man) ....................................................... 49 11 hits [mammals] Potassium channel tetramerisation domain containing 9 [Homo
......

trình tự gốc

>gi|7477592|pir||H70970 hypothetical protein Rv3361c - Mycobacterium tuberculosis (strain H37RV)
MQQWVDCEFTGRDFRDEDLSRLHTERAMFSECDFSGVNLAESQHRGSAFRNCTFERTTLWHSTFAQCSML
GSVFVACRLRPLTLDDVDFTLAVLGGNDLRGLNLTGCRLRETSLVDTDLRKCVLRGADLSGARTTGARLD
DADLRGATVDPVLWRTASLVGARVDVDQAVAFAAAHGLCLAGG
 
vậy túm lại vấn đề là thế nào?
- nội dung "bình lựng" có đáng tin kô? (hì hì hèn gì trường tui kô mua cái Faculty 10001 này, đã vậy nó còn cho free mấy nước đang phát triển nữa chứ)

- nhân sự kiện này cũng nên có lời rõ ràng về chuyện tiếp tục hay ngưng cái vụ này lại tức là vụ dịch Faculty 1001 ấy, nếu tiếp tục thì có nên đưa bản dịch thành bản tin hằng ngày của SHVN kô, hay chỉ để trong forum cho anh em cãi nhau???
 

Cao Xuân Hiếu

Administrator
lonxon said:
vậy túm lại vấn đề là thế nào?
- nội dung "bình lựng" có đáng tin kô? (hì hì hèn gì trường tui kô mua cái Faculty 10001 này, đã vậy nó còn cho free mấy nước đang phát triển nữa chứ)

- nhân sự kiện này cũng nên có lời rõ ràng về chuyện tiếp tục hay ngưng cái vụ này lại tức là vụ dịch Faculty 1001 ấy, nếu tiếp tục thì có nên đưa bản dịch thành bản tin hằng ngày của SHVN kô, hay chỉ để trong forum cho anh em cãi nhau???

Có liên quan gì đến F1000 đâu nhỉ? cái này tôi thấy casper nếu còn đạn thì vẫn cứ nên tiếp tục. Mà anh em cũng có cãi nhau đâu? tội gì thì là do bọn comment đấy chứ. :D chúng nó viết ko rõ ràng thì ta phải tự suy. Mà suy luận thì phải có cái đúng, cái sai, phải ko anh tuchau 8)
 

Ngô Vũ

Member
Okay, bây giờ tui thỏa mản rồi. Chỉ tại tui blast với một trình tự dõm của thằng NCBI (cùng gene name-MfpA), mà không dùng tên Rv3361c như vietbio đã làm. Cảm ơn vietbio một lần nữa. Ông Dan nhà ta chắc phải hắt hơi mấy cái ngày hôm nay vì cái nhận định hồ đồ của tui, xin rút lại lời thất lể với ổng.

Chỉ có điều thú vị là một trong những protein có họ xa lắc xa lơ (chỉ số trình tự tương tự chỉ khoảng 30%) với MfpA ở vi khuẩn là potassium channel, mà cái này lại là một protein gắn trên màng. K channel cũng có vai trò trong việc kháng thuốc, nhưng nếu so sánh với cơ chế của MfpA ở vi khuẩn thì hoàn toàn khác biệt.

To Lonxon: cái binh luận thì vẫn okay, chỉ tại nó hay đốt ngắn giai đoạn (vì chổ cho phép có hạn) nên người đọc như tui thì nghe lùng bùng lổ tai. Do đó tui phải cầu cứu tới vietbio để học hỏi hôm nay.

Faculty 1000 vẫn là một dịch vụ xuất sắc. Quá trình lựa chọn người review của nó đều từ những người top của field đó. Còn việc cãi nhau trong forum thì làm gì có. Hề hề, thử hỏi vietbio coi có cảm thấy nóng giận gì đâu.

Chào.
 

Cao Xuân Hiếu

Administrator
Chỉ có điều thú vị là một trong những protein có họ xa lắc xa lơ (chỉ số trình tự tương tự chỉ khoảng 30%) với MfpA ở vi khuẩn là potassium channel, mà cái này lại là một protein gắn trên màng. K channel cũng có vai trò trong việc kháng thuốc, nhưng nếu so sánh với cơ chế của MfpA ở vi khuẩn thì hoàn toàn khác biệt.

bọn này có điểm chung là đều là những cấu trúc lặp lại, rất kỳ lạ. Trong nghiên cứu của em cũng gặp một motif rất lạ kiểu này. Nhưng ko đủ tiền làm Xray nên chưa biết phải mô phỏng cấu trúc - chức năng như thế nào.
 

Nguyễn Xuân Hưng

Administrator
ok, tôi sẽ tiếp tục. Kể ra mấy bác comment viết thế lại hay. Có cái để mà bình luận, học hỏi lẫn nhau.

Anh tuchau có thể nói rõ hơn cái ý này được không ạ.

potassium channel, mà cái này lại là một protein gắn trên màng. K channel cũng có vai trò trong việc kháng thuốc

Cụ thể là cơ chế kháng thuốc bởi protein gắn trên màng. K channel như thế nào ạ.
 
ja, thì bây giờ em cần nghe 1 câu kết luận chính thức sự việc

- bàn thì cứ bàn, cãi thì cứ cãi, dân VNese mà.

- nhưng mà từ hôm bữa giờ đã cũng hơn 5 bài faculty 1001 rồi, kô biết SHVN có ý định đưa những tin ngắn nho nhỏ này thành bản tin hằng ngày kô? Như vậy thì sẽ làm phong phú bản tin của SHVN, nếu được thì sắp xếp chúng lại.

"Cụ thể là cơ chế kháng thuốc bởi protein gắn trên màng. K channel như thế nào ạ."

==) cái này anh tuchau có thể làm seminar tuần sau được đấy ;)
 

Dương Văn Cường

Administrator
nhưng mà từ hôm bữa giờ đã cũng hơn 5 bài faculty 1001 rồi, kô biết SHVN có ý định đưa những tin ngắn nho nhỏ này thành bản tin hằng ngày kô? Như vậy thì sẽ làm phong phú bản tin của SHVN, nếu được thì sắp xếp chúng lại.
Việc đăng bài thì em làm được. Phần quyết định xin nhường cho những người sẽ cung cấp các bản tin này.
 

Nguyễn Xuân Hưng

Administrator
Việc dịch các tin ngắn nho nhỏ này và đưa lên diễn đàn thì tôi đã làm. Còn đặt nó vào đâu thì tùy các bác. Nhưng theo tôi nếu đã đưa các tin này thành bản tin hàng ngày thì mong các bác xem qua nó hộ tôi chút để sửa các chỗ sai cũng như câu cú. Sau đó cho đi đâu thì cho.
 

Facebook

Top